Lineage for d1vmea2 (1vme A:1-250)
- Root: SCOPe 2.04
Class d: Alpha and beta proteins (a+b) [53931] (380 folds) 
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheetsSuperfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) 
Family d.157.1.3: ROO N-terminal domain-like [56291] (4 proteins) Protein ROO-like flavoprotein TM0755, N-terminal domain [111225] (1 species) Species Thermotoga maritima [TaxId:2336] [111226] (1 PDB entry)
Uniprot Q9WZL4 #
Domain d1vmea2: 1vme A:1-250 [108894]
Other proteins in same PDB: d1vmea1, d1vmeb1
Structural genomics target
complexed with cl, edo, feo
Details for d1vmea2
PDB Entry: 1vme (more details), 1.8 Å
PDB Description: Crystal structure of Flavoprotein (TM0755) from Thermotoga maritima at 1.80 A resolution
PDB Compounds: (A:) FlavoproteinSCOPe Domain Sequences for d1vmea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vmea2 d.157.1.3 (A:1-250) ROO-like flavoprotein TM0755, N-terminal domain {Thermotoga maritima [TaxId: 2336]}
mpkiwterifddpeiyvlridddriryfeavweipegisynaylvklnganvlidgwkgn
yakefidalskivdpkeithiivnhtepdhsgslpatlktighdveiiasnfgkrllegf
ygikdvtvvkdgeereiggkkfkfvmtpwlhwpdtmvtyldgilfscdvgggyllpeild
dsnesvverylphvtkyivtvighyknyilegaeklsslkikallpghgliwkkdpqrll
nhyvsvakgd
SCOPe Domain Coordinates for d1vmea2:
Click to download the PDB-style file with coordinates for d1vmea2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vmea2:
- d1vmea2 first appeared in SCOP 1.69
- d1vmea2 appears in SCOPe 2.03
- d1vmea2 appears in SCOPe 2.05
- d1vmea2 appears in the current release, SCOPe 2.08
View in 3D
