Lineage for d4dika1 (4dik A:-3-250)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1440053Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 1440054Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 1440239Family d.157.1.3: ROO N-terminal domain-like [56291] (4 proteins)
  6. 1440265Protein automated matches [227097] (1 species)
    not a true protein
  7. 1440266Species Thermotoga maritima [TaxId:2336] [226498] (2 PDB entries)
  8. 1440267Domain d4dika1: 4dik A:-3-250 [219779]
    Other proteins in same PDB: d4dika2, d4dikb2
    automated match to d1vmea2
    complexed with cl, feo; mutant

Details for d4dika1

PDB Entry: 4dik (more details), 1.75 Å

PDB Description: flavo di-iron protein h90a mutant from thermotoga maritima
PDB Compounds: (A:) Flavoprotein

SCOPe Domain Sequences for d4dika1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dika1 d.157.1.3 (A:-3-250) automated matches {Thermotoga maritima [TaxId: 2336]}
hhhhmpkiwterifddpeiyvlridddriryfeavweipegisynaylvklnganvlidg
wkgnyakefidalskivdpkeithiivnhtepdasgslpatlktighdveiiasnfgkrl
legfygikdvtvvkdgeereiggkkfkfvmtpwlhwpdtmvtyldgilfscdvgggyllp
eilddsnesvverylphvtkyivtvighyknyilegaeklsslkikallpghgliwkkdp
qrllnhyvsvakgd

SCOPe Domain Coordinates for d4dika1:

Click to download the PDB-style file with coordinates for d4dika1.
(The format of our PDB-style files is described here.)

Timeline for d4dika1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4dika2