SCOPe 2.03: Domain d4dika2: 4dik A:251-398

Lineage for d4dika2 (4dik A:251-398)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.0: automated matches [191330] (1 protein)
   not a true family

6. Protein automated matches [190158] (11 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:2336] [226499] (2 PDB entries)

8. Domain d4dika2: 4dik A:251-398 [219780]
   Other proteins in same PDB: d4dika1, d4dikb1
   automated match to d1vmea1
   complexed with cl, feo; mutant

Details for d4dika2

PDB Entry: 4dik, 1.75 Å

PDB Description: flavo di-iron protein h90a mutant from thermotoga maritima

PDB Compounds: (A:) Flavoprotein

SCOPe Domain Sequences for d4dika2:

Sequence; same for both SEQRES and ATOM records:

>d4dika2 c.23.5.0 (A:251-398) automated matches {Thermotoga maritima [TaxId: 2336]}
pkkgkvtviydsmygfvenvmkkaidslkekgftpvvykfsdeerpaiseilkdipdsea
lifgvstyeaeihplmrftlleiidkanyekpvlvfgvhgwapsaertagellketkfri
lsfteikgsnmderkieeaisllkkele

Timeline for d4dika2:

• d4dika2 is new in SCOPe 2.03-stable
  
• d4dika2 appears in SCOPe 2.04
  
• d4dika2 appears in the current release, SCOPe 2.08