SCOPe 2.03: Domain d4dikb1: 4dik B:-1-250

Lineage for d4dikb1 (4dik B:-1-250)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.3: ROO N-terminal domain-like [56291] (4 proteins)

6. Protein automated matches [227097] (1 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:2336] [226498] (2 PDB entries)

8. Domain d4dikb1: 4dik B:-1-250 [219781]
   Other proteins in same PDB: d4dika2, d4dikb2
   automated match to d1vmea2
   complexed with cl, feo; mutant

Details for d4dikb1

PDB Entry: 4dik, 1.75 Å

PDB Description: flavo di-iron protein h90a mutant from thermotoga maritima

PDB Compounds: (B:) Flavoprotein

SCOPe Domain Sequences for d4dikb1:

Sequence; same for both SEQRES and ATOM records:

>d4dikb1 d.157.1.3 (B:-1-250) automated matches {Thermotoga maritima [TaxId: 2336]}
hhmpkiwterifddpeiyvlridddriryfeavweipegisynaylvklnganvlidgwk
gnyakefidalskivdpkeithiivnhtepdasgslpatlktighdveiiasnfgkrlle
gfygikdvtvvkdgeereiggkkfkfvmtpwlhwpdtmvtyldgilfscdvgggyllpei
lddsnesvverylphvtkyivtvighyknyilegaeklsslkikallpghgliwkkdpqr
llnhyvsvakgd

Timeline for d4dikb1:

• d4dikb1 is new in SCOPe 2.03-stable
  
• d4dikb1 appears in SCOPe 2.04
  
• d4dikb1 appears in the current release, SCOPe 2.08