| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
| Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
| Protein Fibronectin, different Fn3 modules [49270] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [49271] (9 PDB entries) |
| Domain d1fnha2: 1fnh A:93-182 [21977] heparin and integrin binding segment |
PDB Entry: 1fnh (more details), 2.8 Å
SCOPe Domain Sequences for d1fnha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}
nvspprrarvtdatettitiswrtktetitgfqvdavpangqtpiqrtikpdvrsytitg
lqpgtdykiylytlndnarsspvvidasta
Timeline for d1fnha2: