SCOPe 2.06: Domain d1fnha2: 1fnh A:93-182

Lineage for d1fnha2 (1fnh A:93-182)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Fibronectin, different Fn3 modules [49270] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49271] (9 PDB entries)

8. Domain d1fnha2: 1fnh A:93-182 [21977]
   heparin and integrin binding segment

Details for d1fnha2

PDB Entry: 1fnh, 2.8 Å

PDB Description: crystal structure of heparin and integrin binding segment of human fibronectin

PDB Compounds: (A:) protein (fibronectin)

SCOPe Domain Sequences for d1fnha2:

Sequence; same for both SEQRES and ATOM records:

>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}
nvspprrarvtdatettitiswrtktetitgfqvdavpangqtpiqrtikpdvrsytitg
lqpgtdykiylytlndnarsspvvidasta

Timeline for d1fnha2:

• d1fnha2 first appeared (with stable ids) in SCOP 1.55
  
• d1fnha2 appears in SCOPe 2.05
  
• d1fnha2 appears in SCOPe 2.07
  
• d1fnha2 appears in the current release, SCOPe 2.08