Lineage for d1fnha2 (1fnh A:93-182)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2761682Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2761880Protein Fibronectin, different Fn3 modules [49270] (3 species)
  7. 2761883Species Human (Homo sapiens) [TaxId:9606] [49271] (9 PDB entries)
  8. 2761890Domain d1fnha2: 1fnh A:93-182 [21977]
    heparin and integrin binding segment

Details for d1fnha2

PDB Entry: 1fnh (more details), 2.8 Å

PDB Description: crystal structure of heparin and integrin binding segment of human fibronectin
PDB Compounds: (A:) protein (fibronectin)

SCOPe Domain Sequences for d1fnha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}
nvspprrarvtdatettitiswrtktetitgfqvdavpangqtpiqrtikpdvrsytitg
lqpgtdykiylytlndnarsspvvidasta

SCOPe Domain Coordinates for d1fnha2:

Click to download the PDB-style file with coordinates for d1fnha2.
(The format of our PDB-style files is described here.)

Timeline for d1fnha2: