| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
| Protein automated matches [226839] (42 species) not a true protein |
| Species Vibrio vulnificus [TaxId:672] [226284] (1 PDB entry) |
| Domain d4db3a1: 4db3 A:-7-117 [219661] automated match to d2ap1a2 complexed with cl, gol, so4, zn |
PDB Entry: 4db3 (more details), 1.95 Å
SCOPe Domain Sequences for d4db3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4db3a1 c.55.1.0 (A:-7-117) automated matches {Vibrio vulnificus [TaxId: 672]}
nlyfqsnamyygfdvggtkiefgafneklervatervptptddypllletiaglvakydq
efacegkiglglpgmedaddatvltvnvpaakgkplradleakigrsvkiendancfals
eawde
Timeline for d4db3a1: