Lineage for d4db3a1 (4db3 A:1-117)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884835Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2884836Protein automated matches [226839] (64 species)
    not a true protein
  7. 2885762Species Vibrio vulnificus [TaxId:672] [226284] (1 PDB entry)
  8. 2885763Domain d4db3a1: 4db3 A:1-117 [219661]
    Other proteins in same PDB: d4db3a3
    automated match to d2ap1a2
    complexed with cl, gol, so4, zn

Details for d4db3a1

PDB Entry: 4db3 (more details), 1.95 Å

PDB Description: 1.95 angstrom resolution crystal structure of n-acetyl-d-glucosamine kinase from vibrio vulnificus.
PDB Compounds: (A:) n-acetyl-d-glucosamine kinase

SCOPe Domain Sequences for d4db3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4db3a1 c.55.1.0 (A:1-117) automated matches {Vibrio vulnificus [TaxId: 672]}
myygfdvggtkiefgafneklervatervptptddypllletiaglvakydqefacegki
glglpgmedaddatvltvnvpaakgkplradleakigrsvkiendancfalseawde

SCOPe Domain Coordinates for d4db3a1:

Click to download the PDB-style file with coordinates for d4db3a1.
(The format of our PDB-style files is described here.)

Timeline for d4db3a1: