SCOPe 2.04: Domain d4db3a2: 4db3 A:118-303

Lineage for d4db3a2 (4db3 A:118-303)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (42 species)
   not a true protein

7. Species Vibrio vulnificus [TaxId:672] [226284] (1 PDB entry)

8. Domain d4db3a2: 4db3 A:118-303 [219662]
   automated match to d2ap1a1
   complexed with cl, gol, so4, zn

Details for d4db3a2

PDB Entry: 4db3, 1.95 Å

PDB Description: 1.95 angstrom resolution crystal structure of n-acetyl-d-glucosamine kinase from vibrio vulnificus.

PDB Compounds: (A:) n-acetyl-d-glucosamine kinase

SCOPe Domain Sequences for d4db3a2:

Sequence; same for both SEQRES and ATOM records:

>d4db3a2 c.55.1.0 (A:118-303) automated matches {Vibrio vulnificus [TaxId: 672]}
elqdapsvmglilgtgfgggliyegkvfsgrnnvagelghmrlpldawfhlgdnapllgc
gcgkkgcldsylsgrgfellyahyygeekkaidiikanaagdekaaehverfmellaicf
gniftandphvvalggglsnfeliyeempkrvpkyllsvakcpkiikakhgdsggvrgaa
flnikg

Timeline for d4db3a2:

• d4db3a2 first appeared in SCOPe 2.03
  
• d4db3a2 appears in SCOPe 2.05
  
• d4db3a2 appears in the current release, SCOPe 2.08