SCOPe 2.07: Domain d4b6mb_: 4b6m B:

Lineage for d4b6mb_ (4b6m B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.10: Cap-Gly domain [74924] (2 families)

5. Family b.34.10.0: automated matches [227283] (1 protein)
   not a true family

6. Protein automated matches [227098] (2 species)
   not a true protein

7. Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [226500] (1 PDB entry)

8. Domain d4b6mb_: 4b6m B: [219340]
   automated match to d1txqa1
   complexed with fmt

Details for d4b6mb_

PDB Entry: 4b6m, 1.59 Å

PDB Description: trypansoma brucei tubulin binding cofactor b cap-gly domain

PDB Compounds: (B:) tubulin-specific chaperone, putative

SCOPe Domain Sequences for d4b6mb_:

Sequence; same for both SEQRES and ATOM records:

>d4b6mb_ b.34.10.0 (B:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
tihvgdrclcrpgdrlgsvrfvgrvaslkpgywvgvefdepvgkgdgtvkgtrvfqcqpn
yggflrpdqvevgdfppev

Timeline for d4b6mb_:

• d4b6mb_ first appeared in SCOPe 2.03
  
• d4b6mb_ appears in SCOPe 2.06
  
• d4b6mb_ appears in the current release, SCOPe 2.08