| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.10: Cap-Gly domain [74924] (2 families) ![]() |
| Family b.34.10.0: automated matches [227283] (1 protein) not a true family |
| Protein automated matches [227098] (2 species) not a true protein |
| Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [226500] (1 PDB entry) |
| Domain d4b6mb_: 4b6m B: [219340] automated match to d1txqa1 complexed with fmt |
PDB Entry: 4b6m (more details), 1.59 Å
SCOPe Domain Sequences for d4b6mb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4b6mb_ b.34.10.0 (B:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
tihvgdrclcrpgdrlgsvrfvgrvaslkpgywvgvefdepvgkgdgtvkgtrvfqcqpn
yggflrpdqvevgdfppev
Timeline for d4b6mb_: