Lineage for d1txqa1 (1txq A:25-98)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.34: SH3-like barrel [50036] (21 superfamilies)
barrel, partly opened; n*=4, S*=8; meander
the last strand is interrupted by a turn of 3-10 helix
Superfamily b.34.10: Cap-Gly domain [74924] (2 families) 
Family b.34.10.1: Cap-Gly domain [74925] (11 proteins)
Pfam PF01302
Protein Dynactin 1 [141234] (1 species) Species Human (Homo sapiens) [TaxId:9606] [141235] (9 PDB entries)
Uniprot Q14203 1-99! Uniprot Q14203 25-98
Domain d1txqa1: 1txq A:25-98 [119388]
Other proteins in same PDB: d1txqb1
Details for d1txqa1
PDB Entry: 1txq (more details), 1.8 Å
PDB Description: Crystal structure of the EB1 C-terminal domain complexed with the CAP-Gly domain of p150Glued
PDB Compounds: (A:) Dynactin 1SCOPe Domain Sequences for d1txqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1txqa1 b.34.10.1 (A:25-98) Dynactin 1 {Human (Homo sapiens) [TaxId: 9606]}
rplrvgsrvevigkghrgtvayvgatlfatgkwvgvildeakgkndgtvqgrkyftcdeg
hgifvrqsqiqvfe
SCOPe Domain Coordinates for d1txqa1:
Click to download the PDB-style file with coordinates for d1txqa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1txqa1:
- d1txqa1 first appeared in SCOP 1.73
- d1txqa1 appears in SCOPe 2.06
- d1txqa1 appears in the current release, SCOPe 2.08
View in 3D
