SCOPe 2.04: Domain d4amvb2: 4amv B:1-240

Lineage for d4amvb2 (4amv B:1-240)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.1: Class II glutamine amidotransferases [56236] (6 proteins)
   has slightly different topology than other families do

6. Protein Glucosamine 6-phosphate synthase, N-terminal domain [56237] (1 species)

7. Species Escherichia coli [TaxId:562] [56238] (4 PDB entries)
   Uniprot P17169 1-238

8. Domain d4amvb2: 4amv B:1-240 [219059]
   Other proteins in same PDB: d4amva1, d4amvb1, d4amvc1
   complexed with f6r

Details for d4amvb2

PDB Entry: 4amv, 2.05 Å

PDB Description: e.coli glucosamine-6p synthase in complex with fructose-6p

PDB Compounds: (B:) glucosamine--fructose-6-phosphate aminotransferase [isomer izing]

SCOPe Domain Sequences for d4amvb2:

Sequence; same for both SEQRES and ATOM records:

>d4amvb2 d.153.1.1 (B:1-240) Glucosamine 6-phosphate synthase, N-terminal domain {Escherichia coli [TaxId: 562]}
cgivgaiaqrdvaeilleglrrleyrgydsaglavvdaeghmtrlrrlgkvqmlaqaaee
hplhggtgiahtrwathgepsevnahphvsehivvvhngiienheplreelkargytfvs
etdteviahlvnwelkqggtlreavlraipqlrgaygtvimdsrhpdtllaarsgsplvi
glgmgenfiasdqlallpvtrrfifleegdiaeitrrsvnifdktgaevkrqdiesnlqy

Timeline for d4amvb2:

• d4amvb2 first appeared in SCOPe 2.03
  
• d4amvb2 appears in SCOPe 2.05
  
• d4amvb2 appears in the current release, SCOPe 2.08