Lineage for d4amva1 (4amv A:241-608)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1621518Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 1621519Superfamily c.80.1: SIS domain [53697] (4 families) (S)
  5. 1621520Family c.80.1.1: double-SIS domain [53698] (5 proteins)
    duplication: consists of two SIS domains related by pseudo dyad
  6. 1621521Protein "Isomerase domain" of glucosamine 6-phosphate synthase (GLMS) [53699] (1 species)
  7. 1621522Species Escherichia coli [TaxId:562] [53700] (5 PDB entries)
  8. 1621525Domain d4amva1: 4amv A:241-608 [219056]
    Other proteins in same PDB: d4amva2, d4amvb2, d4amvc2
    complexed with f6r

Details for d4amva1

PDB Entry: 4amv (more details), 2.05 Å

PDB Description: e.coli glucosamine-6p synthase in complex with fructose-6p
PDB Compounds: (A:) glucosamine--fructose-6-phosphate aminotransferase [isomer izing]

SCOPe Domain Sequences for d4amva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4amva1 c.80.1.1 (A:241-608) "Isomerase domain" of glucosamine 6-phosphate synthase (GLMS) {Escherichia coli [TaxId: 562]}
dagdkgiyrhymqkeiyeqpnaikntltgrishgqvdlselgpnadellskvehiqilac
gtsynsgmvsrywfeslagipcdveiasefryrksavrrnslmitlsqsgetadtlaglr
lskelgylgslaicnvpgsslvresdlalmtnagteigvastkafttqltvllmlvakls
klkgldasiehdivhglqalpsrieqmlsqdkriealaedfsdkhhalflgrgdqypial
egalklkeisyihaeayaagelkhgplalidadmpvivvapnnelleklksnieevrarg
gqlyvfadqdagfvssdnmhiiemphveeviapifytvplqllayhvalikgtdvdqprn
laksvtve

SCOPe Domain Coordinates for d4amva1:

Click to download the PDB-style file with coordinates for d4amva1.
(The format of our PDB-style files is described here.)

Timeline for d4amva1: