Lineage for d4amvb2 (4amv B:1-240)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548742Family d.153.1.1: Class II glutamine amidotransferases [56236] (6 protein domains)
    has slightly different topology than other families do
  6. 2548788Protein Glucosamine 6-phosphate synthase, N-terminal domain [56237] (1 species)
  7. 2548789Species Escherichia coli [TaxId:562] [56238] (7 PDB entries)
    Uniprot P17169 1-238
  8. 2548802Domain d4amvb2: 4amv B:1-240 [219059]
    Other proteins in same PDB: d4amva1, d4amvb1, d4amvc1
    complexed with f6r

Details for d4amvb2

PDB Entry: 4amv (more details), 2.05 Å

PDB Description: e.coli glucosamine-6p synthase in complex with fructose-6p
PDB Compounds: (B:) glucosamine--fructose-6-phosphate aminotransferase [isomer izing]

SCOPe Domain Sequences for d4amvb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4amvb2 d.153.1.1 (B:1-240) Glucosamine 6-phosphate synthase, N-terminal domain {Escherichia coli [TaxId: 562]}
cgivgaiaqrdvaeilleglrrleyrgydsaglavvdaeghmtrlrrlgkvqmlaqaaee
hplhggtgiahtrwathgepsevnahphvsehivvvhngiienheplreelkargytfvs
etdteviahlvnwelkqggtlreavlraipqlrgaygtvimdsrhpdtllaarsgsplvi
glgmgenfiasdqlallpvtrrfifleegdiaeitrrsvnifdktgaevkrqdiesnlqy

SCOPe Domain Coordinates for d4amvb2:

Click to download the PDB-style file with coordinates for d4amvb2.
(The format of our PDB-style files is described here.)

Timeline for d4amvb2: