Lineage for d1ksr__ (1ksr -)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 104969Family b.1.1.5: E set domains [49208] (25 proteins)
  6. 105067Protein F-actin cross-linking gelation factor (ABP-120), one repeat (ROD 4) [49239] (1 species)
  7. 105068Species Slime mold (Dictyostelium discoideum), different domains [49240] (2 PDB entries)
  8. 105073Domain d1ksr__: 1ksr - [21897]

Details for d1ksr__

PDB Entry: 1ksr (more details)

PDB Description: the repeating segments of the f-actin cross-linking gelation factor (abp-120) have an immunoglobulin fold, nmr, 20 structures

SCOP Domain Sequences for d1ksr__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ksr__ b.1.1.5 (-) F-actin cross-linking gelation factor (ABP-120), one repeat (ROD 4) {Slime mold (Dictyostelium discoideum), different domains}
adpeksyaegpgldggecfqpskfkihavdpdgvhrtdggdgfvvtiegpapvdpvmvdn
gdgtydvefepkeagdyvinltldgdnvngfpktvtvkpa

SCOP Domain Coordinates for d1ksr__:

Click to download the PDB-style file with coordinates for d1ksr__.
(The format of our PDB-style files is described here.)

Timeline for d1ksr__: