SCOPe 2.08: Domain d1ksra_: 1ksr A:

Lineage for d1ksra_ (1ksr A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.10: Filamin repeat (rod domain) [81290] (5 proteins)
   Pfam PF00630

6. Protein F-actin cross-linking gelation factor (ABP-120) repeats [49239] (1 species)

7. Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [49240] (3 PDB entries)
   Uniprot P13466 547-857

8. Domain d1ksra_: 1ksr A: [21897]
   one repeat (Rod 4)

Details for d1ksra_

PDB Entry: 1ksr

PDB Description: the repeating segments of the f-actin cross-linking gelation factor (abp-120) have an immunoglobulin fold, nmr, 20 structures

PDB Compounds: (A:) gelation factor

SCOPe Domain Sequences for d1ksra_:

Sequence; same for both SEQRES and ATOM records:

>d1ksra_ b.1.18.10 (A:) F-actin cross-linking gelation factor (ABP-120) repeats {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
adpeksyaegpgldggecfqpskfkihavdpdgvhrtdggdgfvvtiegpapvdpvmvdn
gdgtydvefepkeagdyvinltldgdnvngfpktvtvkpa

Timeline for d1ksra_:

• d1ksra_ first appeared (with stable ids) in SCOP 1.55, called d1ksr__
  
• d1ksra_ appears in SCOPe 2.07