Lineage for d1ctn_1 (1ctn 24-132)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.5: E set domains [49208] (23 proteins) Protein Chitinase A, N-terminal domain [49233] (1 species) Species Serratia marcescens [TaxId:615] [49234] (4 PDB entries) 
Domain d1ctn_1: 1ctn 24-132 [21876]
Other proteins in same PDB: d1ctn_2, d1ctn_3
Details for d1ctn_1
PDB Entry: 1ctn (more details), 2.3 Å
PDB Description: crystal structure of a bacterial chitinase at 2.3 angstroms resolution
SCOP Domain Sequences for d1ctn_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ctn_1 b.1.1.5 (24-132) Chitinase A, N-terminal domain {Serratia marcescens}
aapgkptiawgntkfaivevdqaataynnlvkvknaadvsvswnlwngdtgttakillng
keawsgpstgssgtanfkvnkggryqmqvalcnadgctasdateivvad
SCOP Domain Coordinates for d1ctn_1:
Click to download the PDB-style file with coordinates for d1ctn_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ctn_1:
- d1ctn_1 appears in SCOP 1.57
- d1ctn_1 appears in the current release, SCOPe 2.08, called d1ctna1
View in 3D
