SCOP 1.63: Domain d1lla_3: 1lla 380-628

Lineage for d1lla_3 (1lla 380-628)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (17 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.3: Hemocyanin, C-terminal domain [81283] (1 protein)

6. Protein Hemocyanin, C-terminal domain [49228] (2 species)
   elaborated with many loop insertions in the common fold

7. Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [49229] (4 PDB entries)

8. Domain d1lla_3: 1lla 380-628 [21861]
   Other proteins in same PDB: d1lla_1, d1lla_2
   complexed with cl, cu, na

Details for d1lla_3

PDB Entry: 1lla, 2.2 Å

PDB Description: crystal structure of deoxygenated limulus polyphemus subunit ii hemocyanin at 2.18 angstroms resolution: clues for a mechanism for allosteric regulation

SCOP Domain Sequences for d1lla_3:

Sequence, based on SEQRES records:

>d1lla_3 b.1.18.3 (380-628) Hemocyanin, C-terminal domain {Horseshoe crab (Limulus polyphemus)}
pydhdvlnfpdiqvqdvtlharvdnvvhtfmreqelelkhginpgnarsikaryyhldhe
pfsyavnvqnnsasdkhatvriflapkydelgneikadelrrtaieldkfktdlhpgknt
vvrhsldssvtlshqptfedllhgvglnehkseycscgwpshllvpkgnikgmeyhlfvm
ltdwdkdkvdgsesvacvdavsycgardhkypdkkpmgfpfdrpihtehisdfltnnmfi
kdikikfhe

Sequence, based on observed residues (ATOM records):

>d1lla_3 b.1.18.3 (380-628) Hemocyanin, C-terminal domain {Horseshoe crab (Limulus polyphemus)}
pydhdvlnfpdiqvqdvtlharvdnvvhtfmreqelelkhginpgnarsikaryyhldhe
pfsyavnvqnnsasdkhatvriflapkydelgneikadelrrtaieldkfktdlhpgknt
vvrhsldssvtlshqptfedllhgvglseycscgwpshllvpkgnikgmeyhlfvmltdw
dkdkvsvacvdavsycgardhkypdkkpmgfpfdrpihtehisdfltnnmfikdikikfh
e

Timeline for d1lla_3:

• d1lla_3 first appeared (with stable ids) in SCOP 1.55
  
• d1lla_3 appears in SCOP 1.61
  
• d1lla_3 appears in SCOP 1.65
  
• d1lla_3 appears in the current release, SCOPe 2.08, called d1llaa3