Lineage for d1llaa3 (1lla A:380-628)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765436Family b.1.18.3: Arthropod hemocyanin, C-terminal domain [81283] (1 protein)
    automatically mapped to Pfam PF03723
  6. 2765437Protein Arthropod hemocyanin, C-terminal domain [49228] (2 species)
    elaborated with many loop insertions in the common fold
  7. 2765438Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [49229] (4 PDB entries)
  8. 2765439Domain d1llaa3: 1lla A:380-628 [21861]
    Other proteins in same PDB: d1llaa1, d1llaa2
    complexed with cl, cu, na

Details for d1llaa3

PDB Entry: 1lla (more details), 2.18 Å

PDB Description: crystal structure of deoxygenated limulus polyphemus subunit ii hemocyanin at 2.18 angstroms resolution: clues for a mechanism for allosteric regulation
PDB Compounds: (A:) hemocyanin (subunit type II)

SCOPe Domain Sequences for d1llaa3:

Sequence, based on SEQRES records: (download)

>d1llaa3 b.1.18.3 (A:380-628) Arthropod hemocyanin, C-terminal domain {Horseshoe crab (Limulus polyphemus) [TaxId: 6850]}
pydhdvlnfpdiqvqdvtlharvdnvvhtfmreqelelkhginpgnarsikaryyhldhe
pfsyavnvqnnsasdkhatvriflapkydelgneikadelrrtaieldkfktdlhpgknt
vvrhsldssvtlshqptfedllhgvglnehkseycscgwpshllvpkgnikgmeyhlfvm
ltdwdkdkvdgsesvacvdavsycgardhkypdkkpmgfpfdrpihtehisdfltnnmfi
kdikikfhe

Sequence, based on observed residues (ATOM records): (download)

>d1llaa3 b.1.18.3 (A:380-628) Arthropod hemocyanin, C-terminal domain {Horseshoe crab (Limulus polyphemus) [TaxId: 6850]}
pydhdvlnfpdiqvqdvtlharvdnvvhtfmreqelelkhginpgnarsikaryyhldhe
pfsyavnvqnnsasdkhatvriflapkydelgneikadelrrtaieldkfktdlhpgknt
vvrhsldssvtlshqptfedllhgvglseycscgwpshllvpkgnikgmeyhlfvmltdw
dkdkvsvacvdavsycgardhkypdkkpmgfpfdrpihtehisdfltnnmfikdikikfh
e

SCOPe Domain Coordinates for d1llaa3:

Click to download the PDB-style file with coordinates for d1llaa3.
(The format of our PDB-style files is described here.)

Timeline for d1llaa3: