Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (17 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (13 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location |
Protein Cyclomaltodextrin glycanotransferase, domain D [49215] (4 species) follows the starch-binding domain C; the catalytic domain A has (beta/alpha)8-barrel fold; family 13 glycosyl hydrolases |
Species Bacillus circulans, different strains [TaxId:1397] [49216] (29 PDB entries) |
Domain d2cxg_1: 2cxg 496-581 [21839] Other proteins in same PDB: d2cxg_2, d2cxg_3, d2cxg_4 complexed with aci, ca, glc, gld |
PDB Entry: 2cxg (more details), 2.5 Å
SCOP Domain Sequences for d2cxg_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cxg_1 b.1.18.2 (496-581) Cyclomaltodextrin glycanotransferase, domain D {Bacillus circulans, different strains} tatptighvgpmmakpgvtitidgrgfgsskgtvyfgttavsgaditswedtqikvkipa vaggnynikvanaagtasnvydnfev
Timeline for d2cxg_1: