Lineage for d2cxg_1 (2cxg 496-581)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 9579Family b.1.1.5: E set domains [49208] (23 proteins)
  6. 9616Protein Cyclodextrin glycosyltransferase, domain E [49215] (5 species)
  7. 9617Species Bacillus circulans, different strains [TaxId:1397] [49216] (27 PDB entries)
  8. 9641Domain d2cxg_1: 2cxg 496-581 [21839]
    Other proteins in same PDB: d2cxg_2, d2cxg_3, d2cxg_4

Details for d2cxg_1

PDB Entry: 2cxg (more details), 2.5 Å

PDB Description: cyclodextrin glycosyltransferase complexed to the inhibitor acarbose

SCOP Domain Sequences for d2cxg_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cxg_1 b.1.1.5 (496-581) Cyclodextrin glycosyltransferase, domain E {Bacillus circulans, different strains}
tatptighvgpmmakpgvtitidgrgfgsskgtvyfgttavsgaditswedtqikvkipa
vaggnynikvanaagtasnvydnfev

SCOP Domain Coordinates for d2cxg_1:

Click to download the PDB-style file with coordinates for d2cxg_1.
(The format of our PDB-style files is described here.)

Timeline for d2cxg_1: