| Class b: All beta proteins [48724] (119 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (17 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (13 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location |
| Protein Cyclomaltodextrin glycanotransferase, domain D [49215] (4 species) follows the starch-binding domain C; the catalytic domain A has (beta/alpha)8-barrel fold; family 13 glycosyl hydrolases |
| Species Bacillus circulans, different strains [TaxId:1397] [49216] (29 PDB entries) |
| Domain d2dij_1: 2dij 497-583 [21836] Other proteins in same PDB: d2dij_2, d2dij_3, d2dij_4 complexed with aci, ca, glc, gld; mutant |
PDB Entry: 2dij (more details), 2.6 Å
SCOP Domain Sequences for d2dij_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dij_1 b.1.18.2 (497-583) Cyclomaltodextrin glycanotransferase, domain D {Bacillus circulans, different strains}
atptighvgpmmakpgvtitidgrgfgsskgtvyfgttavsgaditswedtqikvkipav
aggnynikvanaagtasnvydnfevls
Timeline for d2dij_1: