SCOP 1.61: Domain d2dij_1: 2dij 497-583

Lineage for d2dij_1 (2dij 497-583)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.5: E set domains [49208] (27 proteins)

6. Protein Cyclodextrin glycosyltransferase, domain E [49215] (5 species)

7. Species Bacillus circulans, different strains [TaxId:1397] [49216] (29 PDB entries)

8. Domain d2dij_1: 2dij 497-583 [21836]
   Other proteins in same PDB: d2dij_2, d2dij_3, d2dij_4

Details for d2dij_1

PDB Entry: 2dij, 2.6 Å

PDB Description: complex of a y195f mutant cgtase from b. circulans strain 251 complexed with a maltononaose inhibitor at ph 9.8 obtained after soaking the crystal with acarbose and maltohexaose

SCOP Domain Sequences for d2dij_1:

Sequence; same for both SEQRES and ATOM records:

>d2dij_1 b.1.1.5 (497-583) Cyclodextrin glycosyltransferase, domain E {Bacillus circulans, different strains}
atptighvgpmmakpgvtitidgrgfgsskgtvyfgttavsgaditswedtqikvkipav
aggnynikvanaagtasnvydnfevls

Timeline for d2dij_1:

• d2dij_1 first appeared (with stable ids) in SCOP 1.55
  
• d2dij_1 appears in SCOP 1.59
  
• d2dij_1 appears in SCOP 1.63
  
• d2dij_1 appears in the current release, SCOPe 2.08, called d2dija1