| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) ![]() |
| Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins) N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain) automatically mapped to Pfam PF02866 |
| Protein Lactate dehydrogenase [56339] (19 species) |
| Species Thermus caldophilus [TaxId:272] [226615] (2 PDB entries) |
| Domain d3vpgb2: 3vpg B:163-330 [217998] Other proteins in same PDB: d3vpga1, d3vpgb1, d3vpgc1, d3vpgd1 automated match to d1llda2 complexed with gol |
PDB Entry: 3vpg (more details), 1.8 Å
SCOPe Domain Sequences for d3vpgb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vpgb2 d.162.1.1 (B:163-330) Lactate dehydrogenase {Thermus caldophilus [TaxId: 272]}
tildtarfrallaehlrvapqsvhayvlgehgdsevlvwssaqvggvpllefaeargral
spedraridegvrraayriiegkgatyygigaglarlvrailtdekgvytvsaftpeveg
vlevslslprilgaggvegtvypslspeerealrrsaeilkeaafalgf
Timeline for d3vpgb2: