Lineage for d3vpgb2 (3vpg B:163-330)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1440931Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1440932Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1440933Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 1440940Protein Lactate dehydrogenase [56339] (18 species)
  7. 1441089Species Thermus caldophilus [TaxId:272] [226615] (2 PDB entries)
  8. 1441091Domain d3vpgb2: 3vpg B:163-330 [217998]
    Other proteins in same PDB: d3vpga1, d3vpgb1, d3vpgc1, d3vpgd1
    automated match to d1llda2
    complexed with gol

Details for d3vpgb2

PDB Entry: 3vpg (more details), 1.8 Å

PDB Description: L-lactate dehydrogenase from Thermus caldophilus GK24
PDB Compounds: (B:) l-lactate dehydrogenase

SCOPe Domain Sequences for d3vpgb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vpgb2 d.162.1.1 (B:163-330) Lactate dehydrogenase {Thermus caldophilus [TaxId: 272]}
tildtarfrallaehlrvapqsvhayvlgehgdsevlvwssaqvggvpllefaeargral
spedraridegvrraayriiegkgatyygigaglarlvrailtdekgvytvsaftpeveg
vlevslslprilgaggvegtvypslspeerealrrsaeilkeaafalgf

SCOPe Domain Coordinates for d3vpgb2:

Click to download the PDB-style file with coordinates for d3vpgb2.
(The format of our PDB-style files is described here.)

Timeline for d3vpgb2: