Lineage for d1llda2 (1lld A:150-319)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1440931Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1440932Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1440933Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 1440940Protein Lactate dehydrogenase [56339] (18 species)
  7. 1440961Species Bifidobacterium longum, strain am101-2 [TaxId:216816] [56346] (2 PDB entries)
  8. 1440962Domain d1llda2: 1lld A:150-319 [42144]
    Other proteins in same PDB: d1llda1, d1lldb1
    complexed with nad

Details for d1llda2

PDB Entry: 1lld (more details), 2 Å

PDB Description: molecular basis of allosteric activation of bacterial l-lactate dehydrogenase
PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d1llda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1llda2 d.162.1.1 (A:150-319) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]}
tnldsarlrfliaqqtgvnvknvhayiagehgdsevplwesatiggvpmsdwtplpghdp
ldadkreeihqevknaaykiingkgatnyaigmsgvdiieavlhdtnrilpvssmlkdfh
gisdicmsvptllnrqgvnntintpvsdkelaalkrsaetlketaaqfgf

SCOPe Domain Coordinates for d1llda2:

Click to download the PDB-style file with coordinates for d1llda2.
(The format of our PDB-style files is described here.)

Timeline for d1llda2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1llda1