SCOPe 2.03: Domain d3vpgd1: 3vpg D:21-162

Lineage for d3vpgd1 (3vpg D:21-162)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein Lactate dehydrogenase [51859] (17 species)

7. Species Thermus caldophilus [TaxId:272] [226614] (2 PDB entries)

8. Domain d3vpgd1: 3vpg D:21-162 [218001]
   Other proteins in same PDB: d3vpga2, d3vpgb2, d3vpgc2, d3vpgd2
   automated match to d1llda1
   complexed with gol

Details for d3vpgd1

PDB Entry: 3vpg, 1.8 Å

PDB Description: L-lactate dehydrogenase from Thermus caldophilus GK24

PDB Compounds: (D:) l-lactate dehydrogenase

SCOPe Domain Sequences for d3vpgd1:

Sequence; same for both SEQRES and ATOM records:

>d3vpgd1 c.2.1.5 (D:21-162) Lactate dehydrogenase {Thermus caldophilus [TaxId: 272]}
mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
vmtqvayrlsalppgrvvgsg

Timeline for d3vpgd1:

• d3vpgd1 is new in SCOPe 2.03-stable
  
• d3vpgd1 appears in SCOPe 2.04
  
• d3vpgd1 appears in the current release, SCOPe 2.08