SCOPe 2.08: Domain d3tqvb2: 3tqv B:120-286

Lineage for d3tqvb2 (3tqv B:120-286)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (3 families)
   incomplete beta/alpha barrel with parallel beta-sheet of 7 strands

5. Family c.1.17.0: automated matches [227169] (1 protein)
   not a true family

6. Protein automated matches [226879] (8 species)
   not a true protein

7. Species Francisella tularensis [TaxId:177416] [226222] (1 PDB entry)

8. Domain d3tqvb2: 3tqv B:120-286 [217001]
   Other proteins in same PDB: d3tqva1, d3tqvb1
   automated match to d1qapa1
   complexed with po4

Details for d3tqvb2

PDB Entry: 3tqv, 2.62 Å

PDB Description: structure of the nicotinate-nucleotide pyrophosphorylase from francisella tularensis.

PDB Compounds: (B:) Nicotinate-nucleotide pyrophosphorylase

SCOPe Domain Sequences for d3tqvb2:

Sequence; same for both SEQRES and ATOM records:

>d3tqvb2 c.1.17.0 (B:120-286) automated matches {Francisella tularensis [TaxId: 177416]}
tatvtnklvklisqyktklldtrktipgfrlaqkyavrcgggfnhriglfdaylikenhi
rsaggiakavtkakkldsnkvvevevtnldelnqaiaakadivmldnfsgedidiavsia
rgkvalevsgnidrnsivaiaktgvdfisvgaitkhikaidlslqvq

Timeline for d3tqvb2:

• d3tqvb2 first appeared in SCOPe 2.03
  
• d3tqvb2 appears in SCOPe 2.07