![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
![]() | Superfamily d.41.2: Nicotinate/Quinolinate PRTase N-terminal domain-like [54675] (4 families) ![]() |
![]() | Family d.41.2.0: automated matches [227168] (1 protein) not a true family |
![]() | Protein automated matches [226878] (11 species) not a true protein |
![]() | Species Francisella tularensis [TaxId:177416] [226221] (1 PDB entry) |
![]() | Domain d3tqva1: 3tqv A:7-119 [216998] Other proteins in same PDB: d3tqva2, d3tqvb2 automated match to d1qapa2 complexed with po4 |
PDB Entry: 3tqv (more details), 2.62 Å
SCOPe Domain Sequences for d3tqva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tqva1 d.41.2.0 (A:7-119) automated matches {Francisella tularensis [TaxId: 177416]} ntdqinkvpndivtrlvreslaediatgditaqlaedidttafcitreemilcgqdfane vinqldkniqitwlysdaqkvpanarifelkgnvrsiltaertilnfiqmlsg
Timeline for d3tqva1: