Lineage for d3tqva2 (3tqv A:120-286)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2839614Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (3 families) (S)
    incomplete beta/alpha barrel with parallel beta-sheet of 7 strands
  5. 2839839Family c.1.17.0: automated matches [227169] (1 protein)
    not a true family
  6. 2839840Protein automated matches [226879] (8 species)
    not a true protein
  7. 2839846Species Francisella tularensis [TaxId:177416] [226222] (1 PDB entry)
  8. 2839847Domain d3tqva2: 3tqv A:120-286 [216999]
    Other proteins in same PDB: d3tqva1, d3tqvb1
    automated match to d1qapa1
    complexed with po4

Details for d3tqva2

PDB Entry: 3tqv (more details), 2.62 Å

PDB Description: structure of the nicotinate-nucleotide pyrophosphorylase from francisella tularensis.
PDB Compounds: (A:) Nicotinate-nucleotide pyrophosphorylase

SCOPe Domain Sequences for d3tqva2:

Sequence, based on SEQRES records: (download)

>d3tqva2 c.1.17.0 (A:120-286) automated matches {Francisella tularensis [TaxId: 177416]}
tatvtnklvklisqyktklldtrktipgfrlaqkyavrcgggfnhriglfdaylikenhi
rsaggiakavtkakkldsnkvvevevtnldelnqaiaakadivmldnfsgedidiavsia
rgkvalevsgnidrnsivaiaktgvdfisvgaitkhikaidlslqvq

Sequence, based on observed residues (ATOM records): (download)

>d3tqva2 c.1.17.0 (A:120-286) automated matches {Francisella tularensis [TaxId: 177416]}
tatvtnklvklisqyktklldtrktipgfrlaqkyavrcgggfnhriglfdaylikenhi
giakavtkakkldsnkvvevevtnldelnqaiaakadivmldnfsgedidiavsiargkv
alevsgnidrnsivaiaktgvdfisvgaitkhikaidlslqvq

SCOPe Domain Coordinates for d3tqva2:

Click to download the PDB-style file with coordinates for d3tqva2.
(The format of our PDB-style files is described here.)

Timeline for d3tqva2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3tqva1