| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (3 families) ![]() incomplete beta/alpha barrel with parallel beta-sheet of 7 strands |
| Family c.1.17.0: automated matches [227169] (1 protein) not a true family |
| Protein automated matches [226879] (6 species) not a true protein |
| Species Francisella tularensis [TaxId:177416] [226222] (1 PDB entry) |
| Domain d3tqvb2: 3tqv B:120-286 [217001] Other proteins in same PDB: d3tqva1, d3tqvb1 automated match to d1qapa1 complexed with po4 |
PDB Entry: 3tqv (more details), 2.62 Å
SCOPe Domain Sequences for d3tqvb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tqvb2 c.1.17.0 (B:120-286) automated matches {Francisella tularensis [TaxId: 177416]}
tatvtnklvklisqyktklldtrktipgfrlaqkyavrcgggfnhriglfdaylikenhi
rsaggiakavtkakkldsnkvvevevtnldelnqaiaakadivmldnfsgedidiavsia
rgkvalevsgnidrnsivaiaktgvdfisvgaitkhikaidlslqvq
Timeline for d3tqvb2: