SCOPe 2.08: Domain d1epfa2: 1epf A:98-189

Lineage for d1epfa2 (1epf A:98-189)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein Neural cell adhesion molecule (NCAM) [49166] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [49167] (4 PDB entries)
   Rat and mouse sequences are identical for the two N-terminal modules

8. Domain d1epfa2: 1epf A:98-189 [21695]
   Other proteins in same PDB: d1epfb3, d1epfc3, d1epfd3
   modules 1 and 2
   complexed with ca

Details for d1epfa2

PDB Entry: 1epf, 1.85 Å

PDB Description: crystal structure of the two n-terminal immunoglobulin domains of the neural cell adhesion molecule (ncam)

PDB Compounds: (A:) protein (neural cell adhesion molecule)

SCOPe Domain Sequences for d1epfa2:

Sequence; same for both SEQRES and ATOM records:

>d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
klmfknaptpqefkegedavivcdvvsslpptiiwkhkgrdvilkkdvrfivlsnnylqi
rgikktdegtyrcegrilargeinfkdiqviv

Timeline for d1epfa2:

• d1epfa2 first appeared (with stable ids) in SCOP 1.55
  
• d1epfa2 appears in SCOPe 2.07