PDB entry 1epf

View 1epf on RCSB PDB site
Description: crystal structure of the two n-terminal immunoglobulin domains of the neural cell adhesion molecule (ncam)
Class: cell adhesion
Keywords: ncam, immunoglobulin fold, glycoprotein, cell adhesion
Deposited on 2000-03-29, released 2000-10-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.201
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (neural cell adhesion molecule)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1epfa1, d1epfa2
  • Chain 'B':
    Compound: protein (neural cell adhesion molecule)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13596 (2-190)
      • cloning artifact (0-1)
    Domains in SCOPe 2.07: d1epfb1, d1epfb2, d1epfb3
  • Chain 'C':
    Compound: protein (neural cell adhesion molecule)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13596 (2-190)
      • cloning artifact (1)
    Domains in SCOPe 2.07: d1epfc1, d1epfc2, d1epfc3
  • Chain 'D':
    Compound: protein (neural cell adhesion molecule)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13596 (2-190)
      • cloning artifact (0-1)
    Domains in SCOPe 2.07: d1epfd1, d1epfd2, d1epfd3
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1epfA (A:)
    rvlqvdivpsqgeisvgeskfflcqvagdakdkdiswfspngeklspnqqrisvvwnddd
    sstltiynaniddagiykcvvtaedgtqseatvnvkifqklmfknaptpqefkegedavi
    vcdvvsslpptiiwkhkgrdvilkkdvrfivlsnnylqirgikktdegtyrcegrilarg
    einfkdiqviv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1epfA (A:)
    lqvdivpsqgeisvgeskfflcqvagdakdkdiswfspngeklspnqqrisvvwndddss
    tltiynaniddagiykcvvtaedgtqseatvnvkifqklmfknaptpqefkegedavivc
    dvvsslpptiiwkhkgrdvilkkdvrfivlsnnylqirgikktdegtyrcegrilargei
    nfkdiqviv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1epfB (B:)
    rvlqvdivpsqgeisvgeskfflcqvagdakdkdiswfspngeklspnqqrisvvwnddd
    sstltiynaniddagiykcvvtaedgtqseatvnvkifqklmfknaptpqefkegedavi
    vcdvvsslpptiiwkhkgrdvilkkdvrfivlsnnylqirgikktdegtyrcegrilarg
    einfkdiqviv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1epfC (C:)
    rvlqvdivpsqgeisvgeskfflcqvagdakdkdiswfspngeklspnqqrisvvwnddd
    sstltiynaniddagiykcvvtaedgtqseatvnvkifqklmfknaptpqefkegedavi
    vcdvvsslpptiiwkhkgrdvilkkdvrfivlsnnylqirgikktdegtyrcegrilarg
    einfkdiqviv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1epfC (C:)
    vlqvdivpsqgeisvgeskfflcqvagdakdkdiswfspngeklspnqqrisvvwnddds
    stltiynaniddagiykcvvtaedgtqseatvnvkifqklmfknaptpqefkegedaviv
    cdvvsslpptiiwkhkgrdvilkkdvrfivlsnnylqirgikktdegtyrcegrilarge
    infkdiqviv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1epfD (D:)
    rvlqvdivpsqgeisvgeskfflcqvagdakdkdiswfspngeklspnqqrisvvwnddd
    sstltiynaniddagiykcvvtaedgtqseatvnvkifqklmfknaptpqefkegedavi
    vcdvvsslpptiiwkhkgrdvilkkdvrfivlsnnylqirgikktdegtyrcegrilarg
    einfkdiqviv