Lineage for d1epfa2 (1epf A:98-189)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 9408Family b.1.1.4: I set domains [49159] (21 proteins)
  6. 9519Protein Neural cell adhesion molecule (NCAM) [49166] (1 species)
  7. 9520Species Rat (Rattus norvegicus) [TaxId:10116] [49167] (3 PDB entries)
  8. 9522Domain d1epfa2: 1epf A:98-189 [21695]

Details for d1epfa2

PDB Entry: 1epf (more details), 1.85 Å

PDB Description: crystal structure of the two n-terminal immunoglobulin domains of the neural cell adhesion molecule (ncam)

SCOP Domain Sequences for d1epfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus)}
klmfknaptpqefkegedavivcdvvsslpptiiwkhkgrdvilkkdvrfivlsnnylqi
rgikktdegtyrcegrilargeinfkdiqviv

SCOP Domain Coordinates for d1epfa2:

Click to download the PDB-style file with coordinates for d1epfa2.
(The format of our PDB-style files is described here.)

Timeline for d1epfa2: