Lineage for d3tnwb2 (3tnw B:309-432)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2003386Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2003387Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2003388Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 2003844Protein automated matches [227027] (3 species)
    not a true protein
  7. 2003845Species Cow (Bos taurus) [TaxId:9913] [226306] (3 PDB entries)
  8. 2003847Domain d3tnwb2: 3tnw B:309-432 [216909]
    Other proteins in same PDB: d3tnwa1, d3tnwa2, d3tnwc_
    automated match to d1vina2
    complexed with f18, na

Details for d3tnwb2

PDB Entry: 3tnw (more details), 2 Å

PDB Description: Structure of CDK2/cyclin A in complex with CAN508
PDB Compounds: (B:) Cyclin-A2

SCOPe Domain Sequences for d3tnwb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tnwb2 a.74.1.1 (B:309-432) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ptinqfltqyflhqqpanckveslamflgelslidadpylkylpsviaaaafhlalytvt
gqswpeslvqktgytletlkpclldlhqtylrapqhaqqsirekyknskyhgvsllnppe
tlnv

SCOPe Domain Coordinates for d3tnwb2:

Click to download the PDB-style file with coordinates for d3tnwb2.
(The format of our PDB-style files is described here.)

Timeline for d3tnwb2: