SCOPe 2.08: Domain d3tnwb2: 3tnw B:309-432

Lineage for d3tnwb2 (3tnw B:309-432)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein automated matches [227027] (3 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226306] (7 PDB entries)

8. Domain d3tnwb2: 3tnw B:309-432 [216909]
   Other proteins in same PDB: d3tnwa1, d3tnwa2, d3tnwc_
   automated match to d1vina2
   complexed with f18, na

Details for d3tnwb2

PDB Entry: 3tnw, 2 Å

PDB Description: Structure of CDK2/cyclin A in complex with CAN508

PDB Compounds: (B:) Cyclin-A2

SCOPe Domain Sequences for d3tnwb2:

Sequence; same for both SEQRES and ATOM records:

>d3tnwb2 a.74.1.1 (B:309-432) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ptinqfltqyflhqqpanckveslamflgelslidadpylkylpsviaaaafhlalytvt
gqswpeslvqktgytletlkpclldlhqtylrapqhaqqsirekyknskyhgvsllnppe
tlnv

Timeline for d3tnwb2:

• d3tnwb2 first appeared in SCOPe 2.03
  
• d3tnwb2 appears in SCOPe 2.07