| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (15 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
| Domain d3tnnb2: 3tnn B:109-210 [216897] Other proteins in same PDB: d3tnna_, d3tnnb1, d3tnnc_, d3tnnd1, d3tnne_, d3tnnf1, d3tnnh_, d3tnnl1 automated match to d1aqkl2 complexed with cl, gol, so4 |
PDB Entry: 3tnn (more details), 1.95 Å
SCOPe Domain Sequences for d3tnnb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tnnb2 b.1.1.2 (B:109-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapt
Timeline for d3tnnb2: