PDB entry 3tnn

View 3tnn on RCSB PDB site
Description: Crystal structure of N5-i5 Fab, an ADCC mediating and non-neutralizing CD4i anti-HIV- 1 antibody.
Class: immune system
Keywords: ANTI-HIV-1 ENV ANTIBODY n5-i5, CD4i antibody, ADCC, HIV-1 Env, IMMUNE SYSTEM
Deposited on 2011-09-01, released 2012-09-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-09-26, with a file datestamp of 2012-09-21.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.2
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fab heavy chain of ADCC and non-neutralizing anti-HIV-1 antibody N5-i5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3TNN (0-End)
  • Chain 'B':
    Compound: Fab light chain of ADCC and non-neutralizing anti-HIV-1 antibody N5-i5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3TNN
    Domains in SCOPe 2.07: d3tnnb1, d3tnnb2
  • Chain 'C':
    Compound: Fab heavy chain of ADCC and non-neutralizing anti-HIV-1 antibody N5-i5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3TNN (0-End)
  • Chain 'D':
    Compound: Fab light chain of ADCC and non-neutralizing anti-HIV-1 antibody N5-i5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3TNN
    Domains in SCOPe 2.07: d3tnnd1, d3tnnd2
  • Chain 'E':
    Compound: Fab heavy chain of ADCC and non-neutralizing anti-HIV-1 antibody N5-i5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3TNN (0-End)
  • Chain 'F':
    Compound: Fab light chain of ADCC and non-neutralizing anti-HIV-1 antibody N5-i5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3TNN
    Domains in SCOPe 2.07: d3tnnf1, d3tnnf2
  • Chain 'H':
    Compound: Fab heavy chain of ADCC and non-neutralizing anti-HIV-1 antibody N5-i5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3TNN (0-End)
  • Chain 'L':
    Compound: Fab light chain of ADCC and non-neutralizing anti-HIV-1 antibody N5-i5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3TNN
    Domains in SCOPe 2.07: d3tnnl1, d3tnnl2
  • Heterogens: SO4, GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tnnB (B:)
    qsaltqpasvsgspgqsitisctgtssdvgsynfvswyqqhpgkapklmiyevserpsgi
    snrfsgsksgntasltisglqaedeadyycssyagsttfrvfgggtkltvrgqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tnnB (B:)
    altqpasvsgspgqsitisctgtssdvgsynfvswyqqhpgkapklmiyevserpsgisn
    rfsgsksgntasltisglqaedeadyycssyagsttfrvfgggtkltvrgqpkaapsvtl
    fppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassy
    lsltpeqwkshrsyscqvthegstvektvapt
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3tnnD (D:)
    qsaltqpasvsgspgqsitisctgtssdvgsynfvswyqqhpgkapklmiyevserpsgi
    snrfsgsksgntasltisglqaedeadyycssyagsttfrvfgggtkltvrgqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tnnD (D:)
    altqpasvsgspgqsitisctgtssdvgsynfvswyqqhpgkapklmiyevserpsgisn
    rfsgsksgntasltisglqaedeadyycssyagsttfrvfgggtkltvrgqpkaapsvtl
    fppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassy
    lsltpeqwkshrsyscqvthegstvektvapt
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3tnnF (F:)
    qsaltqpasvsgspgqsitisctgtssdvgsynfvswyqqhpgkapklmiyevserpsgi
    snrfsgsksgntasltisglqaedeadyycssyagsttfrvfgggtkltvrgqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tnnF (F:)
    altqpasvsgspgqsitisctgtssdvgsynfvswyqqhpgkapklmiyevserpsgisn
    rfsgsksgntasltisglqaedeadyycssyagsttfrvfgggtkltvrgqpkaapsvtl
    fppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassy
    lsltpeqwkshrsyscqvthegstvektvapt
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3tnnL (L:)
    qsaltqpasvsgspgqsitisctgtssdvgsynfvswyqqhpgkapklmiyevserpsgi
    snrfsgsksgntasltisglqaedeadyycssyagsttfrvfgggtkltvrgqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tnnL (L:)
    altqpasvsgspgqsitisctgtssdvgsynfvswyqqhpgkapklmiyevserpsgisn
    rfsgsksgntasltisglqaedeadyycssyagsttfrvfgggtkltvrgqpkaapsvtl
    fppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassy
    lsltpeqwkshrsyscqvthegstvektvapt