Lineage for d3tnnl2 (3tnn L:109-210)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2750202Domain d3tnnl2: 3tnn L:109-210 [216903]
    Other proteins in same PDB: d3tnna_, d3tnnb1, d3tnnc_, d3tnnd1, d3tnne_, d3tnnf1, d3tnnh_, d3tnnl1
    automated match to d1aqkl2
    complexed with cl, gol, so4

Details for d3tnnl2

PDB Entry: 3tnn (more details), 1.95 Å

PDB Description: crystal structure of n5-i5 fab, an adcc mediating and non-neutralizing cd4i anti-hiv- 1 antibody.
PDB Compounds: (L:) Fab light chain of ADCC and non-neutralizing anti-HIV-1 antibody N5-i5

SCOPe Domain Sequences for d3tnnl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tnnl2 b.1.1.2 (L:109-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapt

SCOPe Domain Coordinates for d3tnnl2:

Click to download the PDB-style file with coordinates for d3tnnl2.
(The format of our PDB-style files is described here.)

Timeline for d3tnnl2: