Lineage for d3tnnd1 (3tnn D:4-108)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2755061Domain d3tnnd1: 3tnn D:4-108 [216898]
    Other proteins in same PDB: d3tnna_, d3tnnb2, d3tnnc_, d3tnnd2, d3tnne_, d3tnnf2, d3tnnh_, d3tnnl2
    automated match to d1aqkl1
    complexed with cl, gol, so4

Details for d3tnnd1

PDB Entry: 3tnn (more details), 1.95 Å

PDB Description: crystal structure of n5-i5 fab, an adcc mediating and non-neutralizing cd4i anti-hiv- 1 antibody.
PDB Compounds: (D:) Fab light chain of ADCC and non-neutralizing anti-HIV-1 antibody N5-i5

SCOPe Domain Sequences for d3tnnd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tnnd1 b.1.1.0 (D:4-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
altqpasvsgspgqsitisctgtssdvgsynfvswyqqhpgkapklmiyevserpsgisn
rfsgsksgntasltisglqaedeadyycssyagsttfrvfgggtkltvrg

SCOPe Domain Coordinates for d3tnnd1:

Click to download the PDB-style file with coordinates for d3tnnd1.
(The format of our PDB-style files is described here.)

Timeline for d3tnnd1: