SCOPe 2.04: Domain d3tehb1: 3teh B:1-38,B:152-190

Lineage for d3tehb1 (3teh B:1-38,B:152-190)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
   core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different

4. Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families)

5. Family a.6.1.1: Domains B1 and B5 of PheRS-beta, PheT [46956] (1 protein)
   duplication: contains two such domains related by pseudo dyad

6. Protein Domains B1 and B5 of PheRS-beta, PheT [46957] (1 species)

7. Species Thermus thermophilus [TaxId:274] [46958] (11 PDB entries)
   identical sequence to Thermus aquaticus, TaxId: 271

8. Domain d3tehb1: 3teh B:1-38,B:152-190 [216773]
   Other proteins in same PDB: d3teha_, d3tehb2, d3tehb3, d3tehb5, d3tehb6
   automated match to d1jjcb1
   complexed with dah

Details for d3tehb1

PDB Entry: 3teh, 2.85 Å

PDB Description: crystal structure of thermus thermophilus phenylalanyl-trna synthetase complexed with l-dopa

PDB Compounds: (B:) phenylalanyl-tRNA synthetase beta chain

SCOPe Domain Sequences for d3tehb1:

Sequence; same for both SEQRES and ATOM records:

>d3tehb1 a.6.1.1 (B:1-38,B:152-190) Domains B1 and B5 of PheRS-beta, PheT {Thermus thermophilus [TaxId: 274]}
mrvpfswlkayvpelespevleerlaglgfetdriervXeevvldlevtpnrpdalgllg
lardlhalgyalvepeaa

Timeline for d3tehb1:

• d3tehb1 first appeared in SCOPe 2.03
  
• d3tehb1 appears in SCOPe 2.05
  
• d3tehb1 appears in the current release, SCOPe 2.08