| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.6: Putative DNA-binding domain [46954] (1 superfamily) core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different |
Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families) ![]() |
| Family a.6.1.1: Domains B1 and B5 of PheRS-beta, PheT [46956] (1 protein) duplication: contains two such domains related by pseudo dyad |
| Protein Domains B1 and B5 of PheRS-beta, PheT [46957] (1 species) |
| Species Thermus thermophilus [TaxId:274] [46958] (12 PDB entries) identical sequence to Thermus aquaticus, TaxId: 271 |
| Domain d3tehb1: 3teh B:1-38,B:152-190 [216773] Other proteins in same PDB: d3teha_, d3tehb2, d3tehb3, d3tehb5, d3tehb6 automated match to d1jjcb1 protein/RNA complex; complexed with dah |
PDB Entry: 3teh (more details), 2.85 Å
SCOPe Domain Sequences for d3tehb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tehb1 a.6.1.1 (B:1-38,B:152-190) Domains B1 and B5 of PheRS-beta, PheT {Thermus thermophilus [TaxId: 274]}
mrvpfswlkayvpelespevleerlaglgfetdriervXeevvldlevtpnrpdalgllg
lardlhalgyalvepeaa
Timeline for d3tehb1: