Lineage for d3tehb1 (3teh B:1-38,B:152-190)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696351Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
    core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different
  4. 2696352Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families) (S)
  5. 2696353Family a.6.1.1: Domains B1 and B5 of PheRS-beta, PheT [46956] (1 protein)
    duplication: contains two such domains related by pseudo dyad
  6. 2696354Protein Domains B1 and B5 of PheRS-beta, PheT [46957] (1 species)
  7. 2696355Species Thermus thermophilus [TaxId:274] [46958] (12 PDB entries)
    identical sequence to Thermus aquaticus, TaxId: 271
  8. 2696372Domain d3tehb1: 3teh B:1-38,B:152-190 [216773]
    Other proteins in same PDB: d3teha_, d3tehb2, d3tehb3, d3tehb5, d3tehb6
    automated match to d1jjcb1
    protein/RNA complex; complexed with dah

Details for d3tehb1

PDB Entry: 3teh (more details), 2.85 Å

PDB Description: crystal structure of thermus thermophilus phenylalanyl-trna synthetase complexed with l-dopa
PDB Compounds: (B:) phenylalanyl-tRNA synthetase beta chain

SCOPe Domain Sequences for d3tehb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tehb1 a.6.1.1 (B:1-38,B:152-190) Domains B1 and B5 of PheRS-beta, PheT {Thermus thermophilus [TaxId: 274]}
mrvpfswlkayvpelespevleerlaglgfetdriervXeevvldlevtpnrpdalgllg
lardlhalgyalvepeaa

SCOPe Domain Coordinates for d3tehb1:

Click to download the PDB-style file with coordinates for d3tehb1.
(The format of our PDB-style files is described here.)

Timeline for d3tehb1: