Lineage for d1vscb1 (1vsc B:91-196)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 222049Family b.1.1.3: C2 set domains [49142] (7 proteins)
  6. 222101Protein Second domain of vascular cell adhesion molecule-1 (VCAM-1) [49143] (1 species)
  7. 222102Species Human (Homo sapiens) [TaxId:9606] [49144] (3 PDB entries)
  8. 222106Domain d1vscb1: 1vsc B:91-196 [21652]
    Other proteins in same PDB: d1vsca2, d1vscb2
    mutant

Details for d1vscb1

PDB Entry: 1vsc (more details), 1.9 Å

PDB Description: vcam-1

SCOP Domain Sequences for d1vscb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vscb1 b.1.1.3 (B:91-196) Second domain of vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens)}
fpkdpeihlsgpleagkpitvkcsvadvypfdrleidllkgdhlmksqefledadrksle
tkslevtftpviedigkvlvcraklhidemdsvptvrqavkelqvd

SCOP Domain Coordinates for d1vscb1:

Click to download the PDB-style file with coordinates for d1vscb1.
(The format of our PDB-style files is described here.)

Timeline for d1vscb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vscb2