SCOP 1.55: Domain d1vscb1: 1vsc B:91-196

Lineage for d1vscb1 (1vsc B:91-196)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.3: C2 set domains [49142] (7 proteins)

6. Protein Second domain of vascular cell adhesion molecule-1 (VCAM-1) [49143] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49144] (2 PDB entries)

8. Domain d1vscb1: 1vsc B:91-196 [21652]
   Other proteins in same PDB: d1vsca2, d1vscb2

Details for d1vscb1

PDB Entry: 1vsc, 1.9 Å

PDB Description: vcam-1

SCOP Domain Sequences for d1vscb1:

Sequence; same for both SEQRES and ATOM records:

>d1vscb1 b.1.1.3 (B:91-196) Second domain of vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens)}
fpkdpeihlsgpleagkpitvkcsvadvypfdrleidllkgdhlmksqefledadrksle
tkslevtftpviedigkvlvcraklhidemdsvptvrqavkelqvd

Timeline for d1vscb1:

• d1vscb1 appears in SCOP 1.57
  
• d1vscb1 appears in the current release, SCOPe 2.08