![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Class II MHC beta chain, C-terminal domain [88625] (6 species) |
![]() | Species Mouse (Mus musculus), I-A group [TaxId:10090] [88631] (16 PDB entries) probably orthologous to the human HLA-DQ group |
![]() | Domain d1es0b1: 1es0 B:94-189 [21644] Other proteins in same PDB: d1es0a1, d1es0a2, d1es0b2 contains covalently bound peptides |
PDB Entry: 1es0 (more details), 2.6 Å
SCOPe Domain Sequences for d1es0b1:
Sequence, based on SEQRES records: (download)
>d1es0b1 b.1.1.2 (B:94-189) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]} rleqpnvaislsrtealnhhntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngd wtfqvlvmlemtphqgevytchvehpslkspitvews
>d1es0b1 b.1.1.2 (B:94-189) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]} rleqpnvaislsntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngdwtfqvlvm lemtphqgevytchvehpslkspitvews
Timeline for d1es0b1: