Lineage for d1es0b1 (1es0 B:94-189)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8374Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (9 species)
  7. 8422Species Mouse (Mus musculus), I-A(G7) [TaxId:10090] [49141] (2 PDB entries)
  8. 8424Domain d1es0b1: 1es0 B:94-189 [21644]
    Other proteins in same PDB: d1es0a2, d1es0b2

Details for d1es0b1

PDB Entry: 1es0 (more details), 2.6 Å

PDB Description: crystal structure of the murine class ii allele i-a(g7) complexed with the glutamic acid decarboxylase (gad65) peptide 207-220

SCOP Domain Sequences for d1es0b1:

Sequence, based on SEQRES records: (download)

>d1es0b1 b.1.1.2 (B:94-189) Class II MHC, C-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-A(G7)}
rleqpnvaislsrtealnhhntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngd
wtfqvlvmlemtphqgevytchvehpslkspitvews

Sequence, based on observed residues (ATOM records): (download)

>d1es0b1 b.1.1.2 (B:94-189) Class II MHC, C-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-A(G7)}
rleqpnvaislsntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngdwtfqvlvm
lemtphqgevytchvehpslkspitvews

SCOP Domain Coordinates for d1es0b1:

Click to download the PDB-style file with coordinates for d1es0b1.
(The format of our PDB-style files is described here.)

Timeline for d1es0b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1es0b2