![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
![]() | Protein automated matches [226839] (42 species) not a true protein |
![]() | Species Salmonella enterica [TaxId:90371] [226450] (2 PDB entries) |
![]() | Domain d3sk3b1: 3sk3 B:2-199 [216427] automated match to d1g99a1 complexed with cit, edo |
PDB Entry: 3sk3 (more details), 1.9 Å
SCOPe Domain Sequences for d3sk3b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sk3b1 c.55.1.0 (B:2-199) automated matches {Salmonella enterica [TaxId: 90371]} ssklvlvlncgssslkfaiidavngdeylsglaecfhlpearikwkmdgskqeaalgaga ahsealnfivntilaqkpelsaqltaighrivhggekytssvvidesviqgikdsasfap lhnpahligiaealksfpqlkdknvavfdtafhqtmpeesylyalpyslykehgvrryga hgtshfyvtqeaakmlnk
Timeline for d3sk3b1: