Lineage for d3sk3b1 (3sk3 B:2-199)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1857401Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1858517Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1858518Protein automated matches [226839] (49 species)
    not a true protein
  7. 1858901Species Salmonella enterica [TaxId:90371] [226450] (2 PDB entries)
  8. 1858904Domain d3sk3b1: 3sk3 B:2-199 [216427]
    automated match to d1g99a1
    complexed with cit, edo

Details for d3sk3b1

PDB Entry: 3sk3 (more details), 1.9 Å

PDB Description: Crystal structure of Salmonella typhimurium acetate kinase (AckA) with citrate bound at the dimeric interface
PDB Compounds: (B:) acetate kinase

SCOPe Domain Sequences for d3sk3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sk3b1 c.55.1.0 (B:2-199) automated matches {Salmonella enterica [TaxId: 90371]}
ssklvlvlncgssslkfaiidavngdeylsglaecfhlpearikwkmdgskqeaalgaga
ahsealnfivntilaqkpelsaqltaighrivhggekytssvvidesviqgikdsasfap
lhnpahligiaealksfpqlkdknvavfdtafhqtmpeesylyalpyslykehgvrryga
hgtshfyvtqeaakmlnk

SCOPe Domain Coordinates for d3sk3b1:

Click to download the PDB-style file with coordinates for d3sk3b1.
(The format of our PDB-style files is described here.)

Timeline for d3sk3b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3sk3b2